PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D12G1630
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 192aa    MW: 21757.2 Da    PI: 10.9596
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D12G1630genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-162067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT+eEd+ll  +++++G g+W + +++ g+ R++k+c++rw +yl
      Gh_D12G1630 20 RGPWTAEEDKLLTAYIQKHGYGSWGSLPHKAGLERCGKSCRLRWINYL 67
                     89********************************************97 PP

2Myb_DNA-binding56.75.5e-1873118148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ eE++ ++++++ lG++ W++Ia++++ +Rt++++k++w+++l
      Gh_D12G1630  73 RGKFSLEEEQTIIQLHAFLGNR-WSAIAAHLP-KRTDNEIKNHWNTHL 118
                      89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.0791567IPR017930Myb domain
SuperFamilySSF466895.35E-3117114IPR009057Homeodomain-like
SMARTSM007175.1E-121969IPR001005SANT/Myb domain
PfamPF002498.3E-152067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.1E-232174IPR009057Homeodomain-like
CDDcd001672.05E-102267No hitNo description
PROSITE profilePS5129424.71668122IPR017930Myb domain
SMARTSM007175.5E-1772120IPR001005SANT/Myb domain
PfamPF002497.5E-1773118IPR001005SANT/Myb domain
CDDcd001672.17E-1275118No hitNo description
Gene3DG3DSA:1.10.10.603.8E-2675123IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MLSKMRPPSP NRKKEVRLKR GPWTAEEDKL LTAYIQKHGY GSWGSLPHKA GLERCGKSCR  60
LRWINYLRPY IKRGKFSLEE EQTIIQLHAF LGNRWSAIAA HLPKRTDNEI KNHWNTHLKK  120
RLIKMGIDPM THKPSTSPSP KNGSNLSHMT QWESARLQAE ARLSQILPPA PLGGVNSPEA  180
VPGALTYSKP GK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-271812225128MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.103608e-71boll| ovule
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO133461878e-71
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF3362836e-68AF336283.1 Gossypium hirsutum GHMYB25 (ghmyb25) mRNA, complete cds.
GenBankEU8264656e-68EU826465.1 Gossypium hirsutum cultivar Acala Maxxa R2R3 MYB transcription factor gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012438546.11e-116PREDICTED: transcription repressor MYB6-like isoform X1
RefseqXP_012438547.11e-116PREDICTED: transcription repressor MYB6-like isoform X2
SwissprotQ9SPG56e-61MYB76_ARATH; Transcription factor MYB76
TrEMBLA0A0D2U5761e-116A0A0D2U576_G
STRINGPGSC0003DMT4000033821e-79(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01140.13e-81myb domain protein 106